PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C01462.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB_related
Protein Properties Length: 121aa    MW: 13150.3 Da    PI: 12.2635
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C01462.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.9e-122972247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       W ++E+ ++++a  ++G + Wk +a+ +g ++t+ q++s+ qk+
   Pahal.C01462.1 29 EMWAADEHGRFLHALLLFGRD-WKPVAQFVG-TKTATQVRSHAQKH 72
                     67*****************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.93E-152378IPR009057Homeodomain-like
PROSITE profilePS5129413.4412377IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-62678IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-132775IPR006447Myb domain, plants
SMARTSM007171.4E-42775IPR001005SANT/Myb domain
PfamPF002495.9E-102972IPR001005SANT/Myb domain
CDDcd001673.34E-63173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MKLAMAAARN NSSAGKKPRK PYKITRPREM WAADEHGRFL HALLLFGRDW KPVAQFVGTK  60
TATQVRSHAQ KHFLKAQKLG LGAALPPPKP RRGAVLAAHS PSSVRHDDNA VAPGGGRRKF  120
*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981960.11e-39PREDICTED: protein REVEILLE 8-like
SwissprotQ8RWU35e-30RVE8_ARATH; Protein REVEILLE 8
TrEMBLB6SQ503e-38B6SQ50_MAIZE; MYB-related transcription factor
STRINGGRMZM2G115070_P011e-37(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-22MYB_related family protein